uk.oisans.comOisans Valley: Outdoor Adventures in the French Alps

uk.oisans.com Profile

Uk.oisans.com is a subdomain of Oisans.com, which was created on 1997-10-10,making it 26 years ago.

Description:Explore mountaineering, hiking, and mountain biking in Oisans Valley, a stunning ski resort in the French Alps. Discover the beauty of this region through heritage sites, mountain huts, and outdoor activities. ...

Keywords:Oisans Valley, French Alps, ski resort, mountaineering, hiking, mountain biking, outdoor adventures, heritage sites, mountain huts, tourism....

Discover uk.oisans.com website stats, rating, details and status online.Use our online tools to find owner and admin contact info. Find out where is server located.Read and write reviews or vote to improve it ranking. Check alliedvsaxis duplicates with related css, domain relations, most used words, social networks references. Go to regular site

uk.oisans.com Information

HomePage size: 73.094 KB
Page Load Time: 0.832349 Seconds
Website IP Address: 5.196.119.254

uk.oisans.com Similar Website

Bike Oisans | All the info on mountain biking and cycling in Oisans in the French Alps
uk.bike-oisans.com
Alliance Française de Delhi – Learn French, Delf-Dalf Exam, Indo-French Cultural Events
delhi.afindia.org
My Swiss Kitchen - Feeding Foodies in the Alps
myswisskitchen.swisshikingvacations.com
Learn French With Our Guidance - Talk in French
store.talkinfrench.com
French Connection USA | French Connection US
canada.frenchconnection.com
Tỷ số trực tuyến bóng đá, thông tin thi đấu, lịch thi đấu, tỷ số kết quả, thể thao 7M
vn2.7msport.com
Yabla French Video Immersion - The Authentic Way to Learn French
french.yabla.com
French Bulldog Puppy Breeder In Ohio French Bulldog For Sale
m-rbulldogs.tripod.com
Zoar Outdoor Shop | Outdoor Apparel and Accessories - The Outfitters Shop at Zoar Outdoor
shop.zoaroutdoor.com
Welcome - Nineteenth-Century French Studies AssociationNineteenth-Century French Studies Association
ncfs-assn.byu.edu
The Alps Trail Running Guide
elevation.alpsinsight.com
Bourg d'Oisans city at the foot of the Alpe d'Huez and at the gates of the Parc des Ecrins
uk.bourgdoisans.com

uk.oisans.com PopUrls

Oisans Valley: Mountaineering, hiking and mountain biking | Ski resort ...
https://uk.oisans.com/
Bourg-d'Oisans - Oisans Tourisme
https://uk.oisans.com/resorts-and-villages/bourg-doisans/
Discover Oisans - Oisans Tourisme
https://uk.oisans.com/discover-oisans/
Oz-en-Oisans - Oisans Tourisme
https://uk.oisans.com/resorts-and-villages/oz-en-oisans/
Resorts and Villages - Oisans Tourisme
https://uk.oisans.com/resorts-and-villages/
Auris-en-Oisans - Oisans Tourisme
https://uk.oisans.com/resorts-and-villages/auris-en-oisans/
Allemond - Oisans Tourisme
https://uk.oisans.com/resorts-and-villages/allemond/
Things to do - Oisans Tourisme
https://uk.oisans.com/things-to-do/
Valley villages - Oisans Tourisme
https://uk.oisans.com/resorts-and-villages/valley-villages/
Oisans through the seasons - Oisans Tourisme
https://uk.oisans.com/things-to-do/oisans-through-the-seasons/
The Oisans Savoir-Faire Route - Oisans Tourisme
https://uk.oisans.com/discover-oisans/the-oisans-savoir-faire-route/
Glacier hikes with the Mountain Guides Office - Oisans Tourisme
https://uk.oisans.com/things-to-do/sporting-activities/hiking-in-oisans/hiking-routes-in-oisans/
4 skiing areas in Oisans - Oisans Tourisme
https://uk.oisans.com/discover-oisans/4-skiing-areas-in-oisans/
Prepare your stay - Oisans Tourisme
https://uk.oisans.com/prepare-your-stay/
Tourist brochures - Oisans Tourisme
https://uk.oisans.com/prepare-your-stay/practical/tourist-brochures/

uk.oisans.com Httpheader

Accept-Ranges: bytes
Age: 0
Content-Type: text/html; charset=UTF-8
Date: Sat, 11 May 2024 10:17:54 GMT
Server: nginx/1.19.7
Set-Cookie: PHPSESSID=143afcac1155a95499a8373dd5ae7262; path=/
Vary: Accept-Encoding
Via: 1.1 varnish (Varnish/5.0)
X-Cache: MISS
X-Cache-Hits: 0
X-Device: desktop
X-Pingback: https://uk.oisans.com/xmlrpc.php
X-Varnish: 241928451
Transfer-Encoding: chunked

uk.oisans.com Meta Info

charset="utf-8"/
content="IE=edge,chrome=1" http-equiv="X-UA-Compatible"/
content="width=device-width, initial-scale=1.0, minimum-scale=1.0, maximum-scale=5.0, user-scalable=yes" name="viewport"/
content="#da532c" name="msapplication-TileColor"/
content="#ffffff" name="theme-color"/
content="max-snippet:-1, max-image-preview:large, max-video-preview:-1" name="robots"
content="en_US" property="og:locale"
content="website" property="og:type"
content="Oisans Valley: Mountaineering, hiking and mountain biking | Ski resort in the French Alps | Oisans Tourism" property="og:title"
content="https://uk.oisans.com/" property="og:url"
content="Oisans Tourisme" property="og:site_name"/
content="summary_large_image" name="twitter:card"/
content="Oisans Valley: Mountaineering, hiking and mountain biking | Ski resort in the French Alps | Oisans Tourism" name="twitter:title"/

uk.oisans.com Ip Information

Ip Country: France
Latitude: 48.8582
Longitude: 2.3387

uk.oisans.com Html To Plain Text

ourism Oisans Tourisme Discover Oisans Discover Oisans Resorts and Villages 4 skiing areas in Oisans Not to be missed Markets The Oisans Savoir-Faire Route Heritage Mountain Huts Photos of Oisans Webcams in Oisans ResortsVillages Find out more Things to do Things to do Sporting Activities Healthwell-being Leisure activities Events Calendar Prepare your stay Prepare your stay Accommodation Restaurants Practical Mountain Guides Equipment rentals and repairs Tourist offices Tourist brochures Getting to Oisans Website fr Website nl en fr nl Contact us Favourite I am looking for Menu Not to be missed Ideas for discovering the Oisans I'm discovering! Resorts and Villages 22 places to stay in Oisans I'd like to visit! Sporting holidays Fill up on outdoor sports! 3, 2, 1 .. GO! Wellness holidays A time to recharge your batteries, unwind and relax ... Relaxing ... Free shuttle To reach L'alpe d'Huez grand domaine or Les 2 Alpes without a car Board now! Accomdation Events Calendar Activities Webcams Close I would like to book a from to for 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Not-to-be-missed in Oisans! Oisans is a wild and protected mountainous region at the heart of the Alps. It is the ideal destination for outdoor sports activities. Hiking in oisans Find out more Paragliding and aerial sports Find out more Trail in Oisans Find out more Via Ferrata in Oisans Find out more Rock climbing Find out more Swimming Pools and Lakes Find out more Donkey or horse riding Find out more Whitewaters Find out more Out of ideas? Not to be missed Here's a short selection of unmissable places in Oisans… all are great hiking destinations that will leave you with unforgettable memories. The plateau d'Emparis The Natura 2000 area Find out more Lauvitel lake The Ecrins largest lake Find out more La Meije A citadel of ice and granite Find out more Ecrins national Park The oldest and largest national park Find out more Pic Blanc An outstanding 360° view over one-fifth of France Find out more Encore plus à découvrir Retrouvez notre top 10 des lieux incontournables en Oisans ! Find out more Prepare your stay All accommodation Find out more Ski rentals and repairs Find out more Tourist offices Find out more Discover Oisans' treasures Oisans, from iconic resorts to vast, untamed landscapes... Oisans.com is your gateway to the Oisans area, listing not only all the good addresses in Oisans, but also practical services and suggested routes for all types of activities. Explore this magnificent corner of the Alps, located between the départements of Isère (38) and Hautes-Alpes (05). This mountainous area includes 4 major skiing areas (Alpe d’Huez Grand Domaine, Les 2 Alpes, La Grave, and Le Col d’Ornon) and dozens of ski resorts and villages both in the Oisans valleys and perched on the mountainsides. The best-known resorts are Les 2 Alpes and Alpe d’Huez, with the latter famous for its 21 iconic switchbacks frequently tackled by cyclists in the Tour de France race. Do you feel the need for some fresh air and colourful natural landscapes? On our website, you will find everything you need to prepare your holiday in Oisans, whether in the winter or summer, including details of accommodation (campsites, hotels, bed and breakfasts, holiday flats and chalet rentals), shops, services and restaurants, whatever the village or resort you have chosen for your stay in Oisans. Winter and summer activities in Oisans In Oisans, each season will be your favourite You can also find details of all the sports and cultural activities on offer in the various villages. Take a look at our diary of events to see what's going on in Oisans during your stay in the mountains. Oisans also has plenty of magnificent biking routes for motorcycle enthusiasts, who revel in the steep roads and unforgettable scenery. Ideas for stays in Oisans are suggested according to your interests and the type of holiday you're looking for, whether family-orientated, sporting or cultural. #oisanstourisme Post your most beautiful pictures of Oisans on Instagram (#oisanstourisme) Follow us on Follow us on Facebook Follow us on Instagram Follow us on Youtube Oisans… the high mountains right at your fingertips. car train plane Grenoble 1hr Lyon 2hrs Valence 1hr45 Paris 6hrs Marseille 4hrs Genève 2hrs30 Lyon 2hrs30 Valence 2hrs15 Paris 4hrs Marseille 4hrs30 Genève 3hrs30 Paris 4hrs Londres 4hrs30 Amsterdam 4hrs40 Bruxelles 4hrs20 Barcelone 4hrs Berlin 5hrs Dublin 5hrs15 Rome 4hrs30 Come to Oisans Where to stay Contact us Tourist brochures Getting to Oisans Hiking in oisans Rock climbing Whitewaters Trail in Oisans Sporting Activities Ideas for activities, stays and weekends Resorts and Villages Accommodation Espace pro Press relations Photo library Our quality politics Share your experience Tripadvisor Google my Business © 2024 Oisans Tourisme Terms of use Privacy policy CGU Sitemap Information about cookies This website is protected by reCAPTCHA. Privacy regulations and Google terms and conditions of use apply. Oisans Tourisme Top of the...

uk.oisans.com Whois

Domain Name: OISANS.COM Registry Domain ID: 2091505_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.gandi.net Registrar URL: http://www.gandi.net Updated Date: 2023-09-08T01:05:38Z Creation Date: 1997-10-10T04:00:00Z Registry Expiry Date: 2024-10-09T04:00:00Z Registrar: Gandi SAS Registrar IANA ID: 81 Registrar Abuse Contact Email: abuse@support.gandi.net Registrar Abuse Contact Phone: +33.170377661 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: NS-214-B.GANDI.NET Name Server: NS-38-A.GANDI.NET Name Server: NS-81-C.GANDI.NET DNSSEC: unsigned >>> Last update of whois database: 2024-05-17T12:55:02Z <<<